![]() | |
Clinical data | |
---|---|
Trade names | Hepcludex |
Other names | MyrB, Myrcludex-B [1] |
Routes of administration | Subcutaneous |
ATC code | |
Legal status | |
Legal status | |
Identifiers | |
CAS Number | |
DrugBank | |
UNII | |
KEGG | |
ChEMBL | |
Chemical and physical data | |
Formula | C248H355N65O72 |
Molar mass | 5398.951 g·mol−1 |
3D model ( JSmol) | |
| |
|
Bulevirtide, sold under the brand name Hepcludex, is an antiviral medication for the treatment of chronic hepatitis D (in the presence of hepatitis B). [4]
The most common side effects include raised levels of bile salts in the blood and reactions at the site of injection. [4]
Bulevirtide works by attaching to and blocking a receptor (target) through which the hepatitis delta and hepatitis B viruses enter liver cells. [4] By blocking the entry of the virus into the cells, it limits the ability of HDV to replicate and its effects in the body, reducing symptoms of the disease. [4]
Bulevirtide was approved for medical use in the European Union in July 2020. [4]
Bulevirtide is a 47-amino acid peptide with the following sequence: [6]
CH3(CH2)12CO- Gly- Thr- Asn- Leu- Ser- Val- Pro-Asn-Pro-Leu-Gly- Phe-Phe-Pro- Asp- His- Gln-Leu-Asp-Pro- Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp- Trp-Asp-Phe-Asn-Pro-Asn- Lys-Asp-His-Trp-Pro- Glu-Ala-Asn-Lys-Val-Gly- NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
Bulevirtide is indicated for the treatment of chronic hepatitis delta virus (HDV) infection in plasma (or serum) HDV-RNA positive adult patients with compensated liver disease. [4] [7]
Bulevirtide binds and inactivates the sodium/bile acid cotransporter, blocking both HBV and HDV viruses from entering hepatocytes. [8]
The hepatitis B virus uses its surface lipopeptide pre-S1 for docking to mature liver cells via their sodium/bile acid cotransporter (NTCP) and subsequently entering the cells. Myrcludex B is a synthetic N- acylated pre-S1 [9] [10] that can also dock to NTCP, blocking the virus's entry mechanism. [11]
The drug is also effective against hepatitis D because the hepatitis D virus uses the same entry receptor as HBV and is only effective in the presence of a hepatitis B virus infection. [11]
Pre-clinical data in mice suggests that pharmacological inhibition of NTCP-mediated bile salt uptake may also be effective to lower hepatic bile salt accumulation in cholestatic conditions. This reduces hepatocellular damage. [12] An increased ratio of phospholipid to bile salts seen in bile upon NTCP inhibition may further contribute to the protective effect as bile salts are less toxic in presence of phospholipids. [13]
![]() | |
Clinical data | |
---|---|
Trade names | Hepcludex |
Other names | MyrB, Myrcludex-B [1] |
Routes of administration | Subcutaneous |
ATC code | |
Legal status | |
Legal status | |
Identifiers | |
CAS Number | |
DrugBank | |
UNII | |
KEGG | |
ChEMBL | |
Chemical and physical data | |
Formula | C248H355N65O72 |
Molar mass | 5398.951 g·mol−1 |
3D model ( JSmol) | |
| |
|
Bulevirtide, sold under the brand name Hepcludex, is an antiviral medication for the treatment of chronic hepatitis D (in the presence of hepatitis B). [4]
The most common side effects include raised levels of bile salts in the blood and reactions at the site of injection. [4]
Bulevirtide works by attaching to and blocking a receptor (target) through which the hepatitis delta and hepatitis B viruses enter liver cells. [4] By blocking the entry of the virus into the cells, it limits the ability of HDV to replicate and its effects in the body, reducing symptoms of the disease. [4]
Bulevirtide was approved for medical use in the European Union in July 2020. [4]
Bulevirtide is a 47-amino acid peptide with the following sequence: [6]
CH3(CH2)12CO- Gly- Thr- Asn- Leu- Ser- Val- Pro-Asn-Pro-Leu-Gly- Phe-Phe-Pro- Asp- His- Gln-Leu-Asp-Pro- Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp- Trp-Asp-Phe-Asn-Pro-Asn- Lys-Asp-His-Trp-Pro- Glu-Ala-Asn-Lys-Val-Gly- NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
Bulevirtide is indicated for the treatment of chronic hepatitis delta virus (HDV) infection in plasma (or serum) HDV-RNA positive adult patients with compensated liver disease. [4] [7]
Bulevirtide binds and inactivates the sodium/bile acid cotransporter, blocking both HBV and HDV viruses from entering hepatocytes. [8]
The hepatitis B virus uses its surface lipopeptide pre-S1 for docking to mature liver cells via their sodium/bile acid cotransporter (NTCP) and subsequently entering the cells. Myrcludex B is a synthetic N- acylated pre-S1 [9] [10] that can also dock to NTCP, blocking the virus's entry mechanism. [11]
The drug is also effective against hepatitis D because the hepatitis D virus uses the same entry receptor as HBV and is only effective in the presence of a hepatitis B virus infection. [11]
Pre-clinical data in mice suggests that pharmacological inhibition of NTCP-mediated bile salt uptake may also be effective to lower hepatic bile salt accumulation in cholestatic conditions. This reduces hepatocellular damage. [12] An increased ratio of phospholipid to bile salts seen in bile upon NTCP inhibition may further contribute to the protective effect as bile salts are less toxic in presence of phospholipids. [13]